PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G085600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family WOX
Protein Properties Length: 203aa    MW: 23398.3 Da    PI: 7.9182
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G085600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.12e-201172157
                        TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        ++ R+++t+eq+++L elF+   r+ps+e++++++++l    +++ ++V++WFqN++a+e++
  Brast01G085600.1.p 11 KCGRWNPTAEQVKVLTELFRAgLRTPSTEQIQRISTHLgafgKVESKNVFYWFQNHKARERH 72
                        568*****************99**************************************95 PP

2Wus_type_Homeobox109.51.9e-351273364
   Wus_type_Homeobox  3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                        + RW+Pt+eQ+k+L+el+++GlrtP++e+iqri+++L ++Gk+e+kNVfyWFQN+kaRer++
  Brast01G085600.1.p 12 CGRWNPTAEQVKVLTELFRAGLRTPSTEQIQRISTHLGAFGKVESKNVFYWFQNHKARERHH 73
                        78**********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003893.4E-41077IPR001356Homeobox domain
PfamPF000469.0E-181272IPR001356Homeobox domain
SuperFamilySSF466893.04E-121376IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.7E-81471IPR009057Homeodomain-like
CDDcd000861.35E-41474No hitNo description
PROSITE profilePS5007110.1061873IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MEVLSGRVGV KCGRWNPTAE QVKVLTELFR AGLRTPSTEQ IQRISTHLGA FGKVESKNVF  60
YWFQNHKARE RHHHKKRRRV ASSSSDNSSA SCYNEEAAAD GREDLVLQPP DSKREARSYN  120
HHRIMTCYVR DAVEQEEVMW ERPTREVETL ELFPLKAAYD LEAADRLRYV RAGEQQCREI  180
SFFDVANGRD PPLELRLCSF DI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17579KRRRV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0383710.0KF038371.1 Aegilops speltoides isolate PI560752 wuschel-related homeobox protein (WOX5) mRNA, complete cds.
GenBankKF0383720.0KF038372.1 Aegilops speltoides subsp. speltoides isolate PI560529 wuschel-related homeobox protein (WOX5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754290.11e-122PREDICTED: WUSCHEL-related homeobox 9-like
SwissprotQ8W0F11e-112WOX9_ORYSJ; WUSCHEL-related homeobox 9
TrEMBLI1HTH51e-122I1HTH5_BRADI; Uncharacterized protein
STRINGBRADI2G55270.11e-122(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94113643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.17e-31WUSCHEL related homeobox 5